SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A194UMX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A194UMX1
Domain Number 1 Region: 400-624
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.1e-70
Family Capz alpha-1 subunit 0.00000898
Further Details:      
 
Domain Number 2 Region: 80-264
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.85e-61
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.000000486
Further Details:      
 
Domain Number 3 Region: 270-395
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.22e-33
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0000515
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A194UMX1
Sequence length 633
Comment (tr|A0A194UMX1|A0A194UMX1_9PEZI) 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial {ECO:0000313|EMBL:KUI53001.1} KW=Complete proteome; Reference proteome OX=694573 OS=Valsa mali var. pyri. GN=VP1G_00484 OC=Sordariomycetes; Sordariomycetidae; Diaporthales; Valsaceae; Valsa.
Sequence
MKSKLPQHLTRVAALAVTPSRSYGPLYSAQASTLRRPYSTHPPNAKLNLPIDYTTTPLLA
HTSRAALNNPELPVEVREGATKKMNLFQSINDALSIALAEDENVLLFGEDVAFGGVFRCS
MKLAETYGSDRVFNTPLSEQGIMGFAIGCAAEGMRPVAEIQFADYVFPAFDQMVNEAAKF
RYRDGACGRHVGGLTVRMPCGAVGHGALYHSQSPESLFTHVPGFRVIIPRSPLQAKGLLL
AAIRSNDPCIFMEPKVLYRAAVEQVPVAPYELPLSKAEVLKQGSDVTIVSYGQPLYICQS
AIKQAEQELGVSIELIDLRTVYPWDKETVLESVQKTGRCIVVHEAMINAGVGAEVAAAIQ
GDPSTFIRLEAPVVRVAGWSTPTPLLFERFNLPDVATSPMSESLEWVSSFVGDAPPGEPA
NIKALTSSDPNLVKELGPAFQKYNEEQFTTVKLPGSSEPVLVSSHNSLGDGRKSTLKSLG
TYVKEHFPNAAYGVYPIEEDSKLAIIIVANKYSPNNFWNGRWRSLYIFNPADSTLEGSLR
VDVHYYEDGNVRLVTNKAVTASIPSATGSGIAKEISTVEKKYQEELNKGFNSLSEGAFKG
LRRQLPVTRQKIEWDKVASYRLGQDIGGGSSRR
Download sequence
Identical sequences A0A194UMX1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]