SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A195BFQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A195BFQ8
Domain Number 1 Region: 240-424
Classification Level Classification E-value
Superfamily MIR domain 4.45e-60
Family MIR domain 0.000000107
Further Details:      
 
Domain Number 2 Region: 425-599
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.03e-49
Family IP3 receptor type 1 binding core, domain 2 0.000000517
Further Details:      
 
Domain Number 3 Region: 1151-1179,1213-1325
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 2.62e-36
Family IP3 receptor type 1 binding core, domain 2 0.0071
Further Details:      
 
Domain Number 4 Region: 109-218
Classification Level Classification E-value
Superfamily MIR domain 0.0000000000000262
Family MIR domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A195BFQ8
Sequence length 2815
Comment (tr|A0A195BFQ8|A0A195BFQ8_9HYME) Inositol 1,4,5-trisphosphate receptor {ECO:0000313|EMBL:KYM83017.1} KW=Complete proteome; Reference proteome OX=520822 OS=Atta colombica. GN=ALC53_06282 OC=Vespoidea; Formicidae; Myrmicinae; Atta.
Sequence
MGELLGSASFLHLGDIVSLYAEGNVSGFLSTLGLVDDRCVVCPEAGDLSNPPKKFRDCLF
KICPMNRYSAQKQFWKAAKQSASSGTDAILLKRLHHAAEIEKKQNETENKKLLGTVVSYG
NVIQLLHLKSNKFLTVNKRLPALLEKNAMRVYLDANGNEGSWFYIMPFYKLRSDGDSVVV
GDKVIMEPVNAGRQGLHVAANYELSDNPGCKEVNVVNSSTSWKVTLFMEHRENQEEILKG
GDVVRLFHAEQEKFLTMDEYKKKQHVFLRTTGRTSATAATSSKALWEVEVVQHDPCRGGA
GHWNSLFRFKHLATGQYLAAEVDTDEPRESVKGKRDPPGPVYRLVSVPHSNEISSLFELD
PTTLTRGDSLVPQSSFVRLHHICTNTWVHSTSVPIDKDDEKPVMSKVGCATSKEDKEAFA
LRSVSPVEVRDLDFANDACKVLTAMNSKLEKGTISHNERRAVTSLLQDIVYFIAGSENEQ
NKSEALELVVTNVKDGPVRDRQKLLREQYILGQLFKILQAPFLESVEGEGPFLRIEELND
PRHAPYKYMFRLCYRILRLSQQDYRKNQEYIAKHFAFMQKQIGYDILAEDTITALLHNNR
KLLEKHITAAEIETFVGLVRKNMRNWQSRFLDYLSDLCISNKKAIAVTQELICKSVLSEK
NKDILIGTKMVKTQVEVEDIDEKQENAEPKITVIEEFEVVLEWNSGAKSMSLSELSRGAK
MGNVQDAAILDYYRHQLNLFSNMCLNRQYLALNNLSLHLDIDLILKCMEDETVPYELRAS
FCRLMLHLHVDRDPQEQVTPVKYARLWSEIPPKMSINDYDTNKMPDQNKEAVRTKFSSTI
MFVEDYLCNVVAKMWSFGDQEQNKLTFEVVKLARDLIYFGFYSFNDLLSLTKTLLSILDC
VSENESTDGKIPTGDIDLLYVIRASRLYKISLIIKFTQLCVVNYLADTDSEEAAEGGILR
CIGDMGAVMTNLTLGPAGQVLASSSPRPKPLMKKEYPLVMDTKLKIIEILQFILDVRLDY
RISCLLSIFKREFDETALTAAEKTGDVTLGQKAIDLDSISAQAEGIFGSSEECAALDLDG
QGGRTFLRVLLHLAMHDYPPLVSGALHLLFRHFSQRQEVLQAFKQVQLLVSDSDVESYKQ
IKADLDILRQSVEKSELWVYKSKATEEHGNKKKKSKEEEDEATAPRKIPLLSALDKQGSA
IDLDIGPPLHSDQTEEYKKIQQILMRMNKLCIQNLPGGQVKARKHEQRLLRNVGVHTVVL
DLLQVPYDTKEDVRMNELMRLAHDFLQNFCLSNQQNQVLLHKQLDLFLNPGIREAQTICS
IFQDNSVLCNEVGAKVIQHFVHCIETHGKHVQYLKFLQTIVKAENQFIRKCQEMVMQELV
QAGEDVLVFYNDRASFNHFVEMMRSERHRMDESSPLQYHVELVKLLACCTMGKNVNTEIK
CHSLLPLDDIVAVVSHPDCIPEVKEAYINFLNHCYIDTEVEMKEIYTSNHMWSLFEKSFI
VDMGLIATSTHDRQHADTALETYVTSCLMNIISTFFSSPFSDQSTTVQTRQPIFVQLLHA
AFNVSQCAWLNAGQRFNVENCIRTLSDVAKGRGIAIPTDLESQVANMFNKAAMLSRQTSK
WLQAAKQPKIERSQSQLMRLDRSIIEGLQDIVSLLEEQLKPLVQSELSLLVDILYRPELL
FPAATDARKRCENGGFIKRLIKHTEKLLEEKEEKLCVKVLRTLREMMAIDPEYGEKNRSV
GKDVFMLRTKNEGISEQTESETQSESQVGTGSNDQSENRQIIQQEPGDALRNNLLTRYFG
KSFIQNPENVDIGVSRSATITHGPGAKILSRAGRTLHDVQTHLDREGASDLVVELVIKSV
HSPSIFVEVVELGIALLEGGNPIIQRSIFNKLMGADLSQSFFKVFYDKMKDSQQEIKSTV
TVNTSDMAAKAHEDKEGKEVDKLSRKRGSGKPNGMVITDELHEELNQVAASNAQAYANMR
NGLAPGEDTANTLDDLSEKSDRNKSGNSSGGEKEEGQLSPKVLVMQPILRFLQLLCENHN
RELQNFLRNQNNKTNFNLVSETLMFLDCICGSTTGGLGLLGLYINEYNVALINQTLETLT
EYCQGPCHDNQNCIATHESNGLDIITALILNDINPLGKTRMDLVLELKNNASKLLLAIME
SRGDSENAERIMYNMNPKQLVDVACKAFHQESLDDFSDIDDSSTNAEEGVSPKEVGHNIY
ILCHQLAQHNKELAVMLKPSEQNNADPKINKALEYYASHTAQIEIVRHDRTLEQIVFPIP
EICELITMDTKIRVLNTTERDDQGSKVSDFFERTEDMFNEMKWQKKLRGQPLLFWMSSYM
SLWSNILFNCAVLINLIVAFFYPFVDSVPKLSYHLSALIWTVMLASAAIIITLPRESGIR
TFVASTILRLIFSVGPEPTLWLLGFVTITLKVIHLISIIGNQGTLTRSVEQIITNIELLY
HMSYITFCVLGLFMHPFFYSVLLFDVVYREETLLNVIKSVTRNGRSIILTAVLALILVYM
FSIIGFMFFKDDFLVPVDEEIISSIEQKIANTCSAGSKENCDATETISRYASEANVRENK
PEIVNVGGELKERTCDSLVMCIVTTLNQGLRNGGGIGDILRAPSSVEPLFVARVVYDLLF
FFIVIIIVLNLIFGVIIDTFADLRSEKQQKELILKNTCFICGLNRSAFDNKIVSFEEHIK
HEHNMWHYLYFIVLVKVKDPTEFTGPESYVYAMVKDRNLEWFPRLRAKSLAADEGEGEQV
ELRSLQSQLESTQMLVRCLSQQLTELRDQMTEQRKQKQRLGLLNSASAILHNIPT
Download sequence
Identical sequences A0A195BFQ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]