SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A195F3W5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A195F3W5
Domain Number 1 Region: 82-185
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 8.51e-27
Family Steroid-binding domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A195F3W5
Sequence length 231
Comment (tr|A0A195F3W5|A0A195F3W5_9HYME) Membrane-associated progesterone receptor component 2 {ECO:0000313|EMBL:KYN34867.1} KW=Complete proteome; Reference proteome OX=34720 OS=Trachymyrmex septentrionalis. GN=ALC56_10835 OC=Vespoidea; Formicidae; Myrmicinae; Trachymyrmex.
Sequence
RLGSVSLILVKMAEKSGSPAATAPEQQQQQQQQSQFLLDFISEIVKNPLNLALVGVIAIL
VYKIFKSRTRPEEPVQEVKKLPKLRRDFTIEELTKYDGKGPDGRILVAVNGSVYDVTRGA
RFYGPGGPYEAFGGRDASRALARFEVVAATDKYDDLSDLNTTEMNSINEWEEQFKERYDY
VGKLLKPGEAPTNYSDEEDEGSQRETETKSESYDAEKKADHNKAAEKSKSD
Download sequence
Identical sequences A0A195F3W5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]