SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A198GUI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A198GUI7
Domain Number 1 Region: 27-135
Classification Level Classification E-value
Superfamily DNA polymerase III psi subunit 1.96e-30
Family DNA polymerase III psi subunit 0.00000635
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A198GUI7
Sequence length 137
Comment (tr|A0A198GUI7|A0A198GUI7_9ENTR) DNA polymerase III subunit psi {ECO:0000256|PIRNR:PIRNR029225} KW=Complete proteome OX=1354262 OS=Enterobacter soli ATCC BAA-2102. GN=M987_01750 OC=Enterobacteriaceae; Enterobacter.
Sequence
MTSRRDWQLQQLGITQWALRRPTALQGEIAIAIPAHVRLVMVAEALPALNEALIGDVLLS
LKLTPDQVLQLTPERVAMLPPDSRCNSWRMGEVDELALEGSQISSPVLEELKANPKARSA
LWQQICKYEHDFFPHDA
Download sequence
Identical sequences A0A198GUI7 G2S4Q0
gi|345297756|ref|YP_004827114.1| WP_014068793.1.75813 WP_014068793.1.95910 WP_014068793.1.96315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]