SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A199UG84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A199UG84
Domain Number 1 Region: 90-160
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.75e-18
Family Skp1 dimerisation domain-like 0.00039
Further Details:      
 
Domain Number 2 Region: 16-80
Classification Level Classification E-value
Superfamily POZ domain 0.00000000141
Family BTB/POZ domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A199UG84
Sequence length 355
Comment (tr|A0A199UG84|A0A199UG84_ANACO) SKP1-like protein 21 {ECO:0000313|EMBL:OAY63575.1} KW=Complete proteome; Reference proteome OX=4615 OS=Ananas comosus (Pineapple) (Ananas ananas). GN=ACMD2_06656 OC=Bromelioideae; Ananas.
Sequence
MSESEMAIIKPEAVKSYIWLQCADGSIQQVEEEVAMFCPMICREVLQKGMGSSKNYAISL
PQRVNPAILSLILDYCRFHQVPGRSNKERKSFDEKFIRIDTKRLCELTSAADSLQLKPLV
DLTSRALARMIEGKTPEEIRETFHLPDDLTEEEKLEPLKNANDDPRIRLLNRLYAKKRKE
LKERQKLKDIEVEEEPKDERSVEEILSFINGDGDSKSVKVPKSKKKNRRKKDHSKDSPRT
DSEQVQKKGTSVPLSSTEDSGKSTLSRSLDVRESVEYPFEPKDEFEDADVDDELDPAMQE
ELDREVEDFARRLNSDWPERVQEILSLGEDTRTGSNLINGNGSARKYTDTGLERR
Download sequence
Identical sequences A0A199UG84

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]