SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1A0HJH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A0HJH5
Domain Number 1 Region: 1-277
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.46e-67
Family Capz beta-1 subunit 0.000000874
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A0HJH5
Sequence length 292
Comment (tr|A0A1A0HJH5|A0A1A0HJH5_9ASCO) F-actin capping protein, beta subunit {ECO:0000313|EMBL:OBA24165.1} KW=Complete proteome; Reference proteome OX=869754 OS=Metschnikowia bicuspidata var. bicuspidata NRRL YB-4993. GN=METBIDRAFT_36834 OC=Saccharomycetes; Saccharomycetales; Metschnikowiaceae; Metschnikowia.
Sequence
MADKFDASLDLLRRLDPKRVSENLNSICSLVQLDGSDEGVELAQDLLAAVDTPLQIARCP
DTNKQFLCCDYNRDGDLYRSPFSNQYVPPTDDDELPYPSALLRQLEIKANESFDVYRDLY
YEGGGLASVYMWDTAEDLEANSIEEGFAGVVLFKKETEDRSGKWDSVHVFEVVPESSTQA
TYKVTSSVILDVQKDQAAQGHRPFSLSGTMTRQLQTTQSLSTDGGSLEWAHLVNLGQLVE
KSETNVRNLLQDVYFDKLKDIFLKDLRSLGDVSERRAEDIKQKELIKGLQGL
Download sequence
Identical sequences A0A1A0HJH5
XP_018714646.1.9870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]