SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A3CGY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A3CGY3
Domain Number 1 Region: 88-155
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 1.44e-27
Family Cyanase C-terminal domain 0.0000315
Further Details:      
 
Domain Number 2 Region: 9-85
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.69e-17
Family Cyanase N-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A3CGY3
Sequence length 156
Comment (tr|A0A1A3CGY3|A0A1A3CGY3_MYCAS) Cyanate lyase {ECO:0000256|HAMAP-Rule:MF_00535} KW=Complete proteome OX=1790 OS=Mycobacterium asiaticum. GN=A5640_20005 OC=Mycobacterium.
Sequence
MSHAQLDPVARQRLAVAAVDAKIAKDLTWQEIADAAGLSVVFTTAAVLGQHALPKKAAAA
VADLLGLGDDAARLLQTIPMRGSIPGGVPSDPTIYRLYEMIQTYGTTLKAIIHEQFGDGI
ISGINFKLDVAKVPDPEGGERAVITLNGKYLPVKPF
Download sequence
Identical sequences A0A1A3CGY3
WP_036363910.1.14591 WP_036363910.1.30156 WP_036363910.1.32594 WP_036363910.1.61104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]