SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A5VGF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A5VGF7
Domain Number 1 Region: 1-155
Classification Level Classification E-value
Superfamily PTS IIb component 1.57e-42
Family PTS IIb component 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A5VGF7
Sequence length 156
Comment (tr|A0A1A5VGF7|A0A1A5VGF7_PEDAC) Protein-N(Pi)-phosphohistidine--sugar phosphotransferase {ECO:0000313|EMBL:OBR27912.1} KW=Complete proteome OX=1254 OS=Pediococcus acidilactici. GN=BTW26_00760 OC=Pediococcus; Pediococcus acidilactici group.
Sequence
MIKVIRIDHRLLHGQVIFAWTKSQGIERIVVIDNVAAGDDFKKMSLKLSKPADIKLSVFS
VDQAKERIAKINNLKSNTMIIFGDVLQAGQIVPLLEGVKEINYGGVKNRPDTKRFSNAVF
LTEEEVKCSQELKNLGFDLYMQQVPTSKRESLNELI
Download sequence
Identical sequences A0A1A5VGF7 E0NHF9 K9IBR2
WP_002830908.1.10972 WP_002830908.1.12913 WP_002830908.1.15931 WP_002830908.1.16740 WP_002830908.1.18031 WP_002830908.1.21491 WP_002830908.1.25614 WP_002830908.1.296 WP_002830908.1.36892 WP_002830908.1.37184 WP_002830908.1.38258 WP_002830908.1.51214 WP_002830908.1.79777 WP_002830908.1.89049 WP_002830908.1.89660 WP_002830908.1.91231 WP_002830908.1.9781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]