SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1A6A6Y8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A6A6Y8
Domain Number 1 Region: 8-271
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.45e-76
Family Capz beta-1 subunit 0.000000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A6A6Y8
Sequence length 292
Comment (tr|A0A1A6A6Y8|A0A1A6A6Y8_9TREE) Capping protein (Actin filament) muscle Z-line, beta {ECO:0000313|EMBL:OBR85813.1} KW=Complete proteome; Reference proteome OX=1296121 OS=Kwoniella dejecticola CBS 10117. GN=I303_03526 OC=Tremellomycetes; Tremellales; Cryptococcaceae; Kwoniella.
Sequence
MADVDLTFDSLLDLLRRLPPTRVEENVNALCDLAPDYADDLLGNVDQPLKILTDSEKGRE
FLGCDYNRDGDSFRSPWSNDYLPEATGGPVPSARLRELEISLNAAFDTYREMYFEGGTSS
VYLWDLEDDPGQGKEISFAGVVLLKKADQPETTPSGSWDSLHVFECQERGRSAKYKLTST
VMLVLETRTLAKIEGKEADEKSAGKGAVTLSGSMTRQAEVDYPLTNSAGHIPNIGRMVED
MEIKMRNLLSSVYFGKTKDVINDLRSQSGLEMKSKEDLLRAELAGKLGARKA
Download sequence
Identical sequences A0A1A6A6Y8
XP_018263655.1.23705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]