SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1A6FY61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A6FY61
Domain Number 1 Region: 266-446
Classification Level Classification E-value
Superfamily MIR domain 1.66e-61
Family MIR domain 0.000000116
Further Details:      
 
Domain Number 2 Region: 1115-1241
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 4.05e-29
Family IP3 receptor type 1 binding core, domain 2 0.01
Further Details:      
 
Domain Number 3 Region: 450-552
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.23e-27
Family IP3 receptor type 1 binding core, domain 2 0.0000132
Further Details:      
 
Domain Number 4 Region: 152-248
Classification Level Classification E-value
Superfamily MIR domain 0.000000000000144
Family MIR domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A6FY61
Sequence length 2790
Comment (tr|A0A1A6FY61|A0A1A6FY61_NEOLE) Uncharacterized protein {ECO:0000313|EMBL:OBS58097.1} KW=Complete proteome; Reference proteome OX=56216 OS=Neotoma lepida (Desert woodrat). GN=A6R68_10757 OC=Muroidea; Cricetidae; Neotominae; Neotoma.
Sequence
MSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRGDDCDDLQCS
GDDSDDLHCLEDDFDDLQCLEDDYDDLQCLLPGDDYCLFKVCPMNRYSAQKQYWKAKQTK
QDKEKIADVVLLQKLQHAAQMEQKQNDTENKKLLHMKSNKYLTVNKRLPALLEKNAMRVT
LDATGNEGSWLFIQPFWKLRSNGDNVVVGDKVILNPVNAGQPLHASNYELSDNAGCKEVN
SVNCNTSWKINLFMQFRDHLEEVLKGGDVVRLFHAEQEKFLTCDEYKGKLQVFLRTTLRQ
SATSATSSNALWEVEVVHHDPCRGGAGHWNGLYRFKHLATGNYLAAEGAQGRTGRRNAGE
KIKYRLVAVPHGNDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNAPIDVE
EERPIRLMLGTCPTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAIFGILKAPFRDKG
GEGPLVRLEELSDQKNAPYQYMFRLCYRVLRHSQEDYRKNQEHIAKQFGMMQSQIGYDIL
AEDTITALLHNNRKLLEKHITKTEVETFVSLHLPESVVNLKVNLNLCLPRPLTLSLCPVR
GRCNGLLPLDSVEGGQLGFRPAGQLLSLLLALLTPSRFLDYLSDLCVSNHIAIPVTQELI
CKCVLDPKNSDILIQTELRPVKEMAQSHEYLSIEYSEEEVWLTWTDRNNEHHEKSVRQLA
QEARAGNAHDENVLSYYRYQLKLFARMCLDRQYLAIDEISKQLGVDLLFLCMADEMLPFD
LRASFCHLMLHVHVDRDPQELVTPVKFARLWTEIPTAITIKDYDSNLNASRDDKKNKFAS
TMEFVEDYLNNVVSEAVPFANEEKNKLTFEVVSLAHNLIYFGFYSFSELLRLTRTLLGII
DCVQASPAMLQAYEEPGGKNVRRSIQGVGHMMSTMVLSRKQSVFGASSLPAGAGVPEPLD
RSKFEDNEDIVVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDTANMNL
DRIGEQAEAMFGVGKTSSMLEVDDEGGRMFLRVLLHLTMHDYAPLVSGALQLLFKHFSQR
QEAMHTFKQVQLLISAQDVENYKVIKSELDRLRMMVEKSELWVDKKGSLKGEEGEAGATK
DKKEILERLNKMCGVGEQMRKKQQRLLKNMDAHKVMLDLLQIPYDKSDNKMLEILRYTHQ
FLQKFCAGNPGNQALLHKHLQLFLTPGLLEAETMQHIFLNNYQLCSEISEPVLQHFVHLL
ATHGRHVQYLDFLHTVIKAEGKYVKKCQDMIMTELTNAGDDVVVFYNDKASLAHLLDMMK
AARDGVEDHSPLMYHISLVDLLAACAEGKNVYTEIKCTSLLPLEDVVSVVTHEDCITEVK
MAYVNFVNHCYVDTEVEMKEIYTSNHIWTLFENFTLDMALVCNKREKRLADPTLEKYVLT
VVLDTISAFFSSPFSENSTSLQTHQTIVVQLLQSTTRLLECPWLQQQHKGSVEACVRTLA
MVAKSRAILLPMDLDAHMSALLSSGGSCAAAAQRSAANYKTATRTFPRVIPTANQWDYKN
IIEKLQDIITALEERLKPLVQAELSVLVDMLHWPELLFLEGSEAYQRCESGGFLSKLIRH
TKGLMESEEKLCVKVLRTLQQMLLKKNKYGDRVSVDTTRLEQGLRMQDIGHQRPHLTFQG
NQLRKMLLQNYLQNRKSSSRGELPDPTGSGLDQDWSAIAATQCRLDKEGATKLVCDLITS
TKNEKIFQESIGLAIRLLDGGNTEIQVRGWDQSAFTSGDAACLGEAMVLRLEAWVLEATF
RIFSTEQQTVSLTMMEVPSISSEEETKSVFSWYLCFGKDKSFYNLMTSDKKSERFFRVLH
DRMKRAQQETKSTVAVNMSDLGSQPREDREPADPTTKGRVASFSMPSSSRYSLGPSLHRG
HEMSERAQSNEMGTSVLIMRPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFL
DIMCGSTTGGLGLLGLYINEDNVGLVIQTLETLTEYCQGPCHENQTCIVTHESNGXDIIT
ALILNDISPLCKYRMDLVLQLKDNASKLLLALMESRHDSENAERILISLRPQELVDVIKK
AYLQEEERENSEVSPREVGHNIYILALQLSRHNKQLQHLLKPVKRIQEEEAEGISSMLSL
NNKQLSQMLKSSVPAQEEEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPGICQFLTEET
KHRLFTTTEQDEQGSKVSDFFDQSSFLHNEMEWQRRLRSMPLIYWFSRRMTLWGSISFNL
AVFINIIIAFFYPYVEGASTGVLGSPLISLLFWILICFSIXALFTKRYSVRPLIVALILR
SIYYLGIGPTLNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSV
LGLFAHELFYSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFL
KDDFILEVDRLPGNHSRASTLGMSHGAATFVGTCSGDKIDCVSEVSVPEILEEEEELDST
ERACDTLLMCIVTVMNHGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFIVIIIVLNL
IFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKLEHNMWNYLYF
IVLVRVKNKTDYTGPESYVAQMIKVSVYATPGPALLVYNLGGDAASAGLGLKVDSCRRLL
GQPGSEEQLGTLFQNKNLDWFPRMRAMSLVSSEGEGEQNEIRILQEKLGSTMKLVSHLTA
QLNELKEQMTEQRKRRQRLGFVDVQNCMSR
Download sequence
Identical sequences A0A1A6FY61

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]