SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A6G2I3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A6G2I3
Domain Number 1 Region: 1-175
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.27e-67
Family Transglutaminase core 0.00000208
Further Details:      
 
Domain Number 2 Region: 184-295
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.62e-27
Family Transglutaminase, two C-terminal domains 0.00033
Further Details:      
 
Domain Number 3 Region: 298-346
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0000000000000767
Family Transglutaminase, two C-terminal domains 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A6G2I3
Sequence length 348
Comment (tr|A0A1A6G2I3|A0A1A6G2I3_NEOLE) Uncharacterized protein {ECO:0000313|EMBL:OBS60403.1} KW=Complete proteome; Reference proteome OX=56216 OS=Neotoma lepida (Desert woodrat). GN=A6R68_08482 OC=Muroidea; Cricetidae; Neotominae; Neotoma.
Sequence
MRCLGIPTRVITNFDSGHDTDGNLIIDEYYDSTGRILENMKKDTVWNYHVWNECWMARRD
LPPGHGGWQVLDATPQETSNGLYCCGPASVKAIKEGEVDLNYDTRFAFSMVNADCMSWLV
SGGKEQKIHQDTAAVGNFISTKSIQSDERDDITDSYKYEEGSLQERQVFLKALQKLKAGS
DVIQVSLKFELLDPPNMGQDINFVLLAVNMSPQFKDLKLNLSAQSLLHDGSPLAPFWQDV
AYITLFPQEEKTYPCKILYSQYSQYLSTDKLIRVSALGEEKNSPEKILVNKIITLTFPGI
MINVLGAAFVNQPLTVQVVFSNPLSEPVEDCVLTLEGSGLFRKQQRVL
Download sequence
Identical sequences A0A1A6G2I3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]