SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A6GHQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A6GHQ4
Domain Number 1 Region: 1-40
Classification Level Classification E-value
Superfamily BEACH domain 0.0000000000209
Family BEACH domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A6GHQ4
Sequence length 40
Comment (tr|A0A1A6GHQ4|A0A1A6GHQ4_NEOLE) Uncharacterized protein {ECO:0000313|EMBL:OBS65295.1} KW=Complete proteome; Reference proteome OX=56216 OS=Neotoma lepida (Desert woodrat). GN=A6R68_06165 OC=Muroidea; Cricetidae; Neotominae; Neotoma.
Sequence
MFVNSNGYQLGVREDEVVVNDVDLPPWAKKPEDFVRINRM
Download sequence
Identical sequences A0A1A6GHQ4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]