SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A6HAA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A6HAA2
Domain Number 1 Region: 159-261
Classification Level Classification E-value
Superfamily TIMP-like 0.00000000000000377
Family Tissue inhibitor of metalloproteinases, TIMP 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A6HAA2
Sequence length 263
Comment (tr|A0A1A6HAA2|A0A1A6HAA2_NEOLE) Uncharacterized protein {ECO:0000313|EMBL:OBS74815.1} KW=Complete proteome; Reference proteome OX=56216 OS=Neotoma lepida (Desert woodrat). GN=A6R68_14685 OC=Muroidea; Cricetidae; Neotominae; Neotoma.
Sequence
MPFRDLQCALYNGHPVLGTQKTYQWVPFHGALVARDGRYVLNGHGALSLPGTYEAAGTRV
VYTRGAGPEETLQATGPTSQELLLQVLLREPNPGVHFEFWLPRERYGPFXAQAQALGWPL
RQPQPREVEPQPAETPVVPEAIPARVESLTPADPPDPRCHLRSVFQARVLGRHRQAEETR
YEVRVLLIYKNHSPLRTREYVWAPGHCPCPPLXPHREYLLAVRRLVSPDGTQDRLLLPHA
GYARLWSPAEDSRVRLAARRCPV
Download sequence
Identical sequences A0A1A6HAA2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]