SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A6TXH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A6TXH9
Domain Number 1 Region: 68-142
Classification Level Classification E-value
Superfamily FlaG-like 3.79e-17
Family FlaG-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A6TXH9
Sequence length 150
Comment (tr|A0A1A6TXH9|A0A1A6TXH9_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:OBU18786.1} KW=Complete proteome OX=512643 OS=Photobacterium aquimaris. GN=AYY19_02670 OC=Vibrionaceae; Photobacterium.
Sequence
MAITSTTAATGLHTALQTSLNSTASATANTANQSISDPTYSELQPSGKPLPLITALTDVD
DVNHPLDDNPLNSFTPDLIAEQERIKQIEQVLQQVNRSLRFHQDEETGEQIATIVDKTSG
EVIRQVPAQELLELNKNLAKHALGSISKTV
Download sequence
Identical sequences A0A1A6TXH9
WP_065166470.1.79258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]