SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A6Y0L5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A6Y0L5
Domain Number 1 Region: 4-202
Classification Level Classification E-value
Superfamily YcfC-like 3.4e-61
Family YcfC-like 0.0000459
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A6Y0L5
Sequence length 204
Comment (tr|A0A1A6Y0L5|A0A1A6Y0L5_STEMA) High frequency lysogenization protein HflD homolog {ECO:0000256|HAMAP-Rule:MF_00695, ECO:0000256|SAAS:SAAS00958394} KW=Complete proteome OX=40324 OS=maltophilia). GN=A9K58_06770 OC=Stenotrophomonas maltophilia group.
Sequence
MSFTVDDRVLALAGIAQALQQVRRIADTGHSDAAAVRTAVDSVFRVDASSPQAVFGDRHA
LKSGLRLLHNYFRSQGQDPILPKLALSVLQLERRFVQEGATVNKVAAGIERAERQAAELG
DSAHPDVLATLGGLYADTISHLKPRVMVQGNPHYLGQAGVVAEIRALLLAAVRSAVLWRQ
LGGSYWDFLFSRKAMIEAVDRQLA
Download sequence
Identical sequences A0A1A6Y0L5
WP_065198624.1.66203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]