SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A7W508 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A7W508
Domain Number 1 Region: 24-167
Classification Level Classification E-value
Superfamily MIR domain 2.22e-27
Family MIR domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A7W508
Sequence length 224
Comment (tr|A0A1A7W508|A0A1A7W508_PLAKH) Dolichyl-phosphate-mannose protein mannosyltransferase, putative {ECO:0000313|EMBL:SBO29449.1} KW=Complete proteome OX=5851 OS=Plasmodium knowlesi (strain H). GN=PKNA1_C2_0810500 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MSCYRLFVEVFLFSFFFFKVHSCLYVTDGSSIILENVGTSYKLFSTDMKWGSGSGNQLVT
TVTTNKNEENLLWTVNIYDDAKSFTGNKINCDEIITLKHVKSNGYLMGSSHESILSNNYE
LSVHQSKELAKFQVICENKKSSPYWSVGENIYLKSVDHNGYVSTSKSYEFNQYNCHNCPI
LYHLEACIMRYTYPRNDQKWKAKSGVIITQFNDERGEKFNVDEL
Download sequence
Identical sequences A0A1A7W508 A0A1Y3DMS4 B3L3P7
5850.PKH_081020 PKH_081020 gi|193808815|emb|CAQ39517.1| gi|221055213|ref|XP_002258745.1| XP_002258745.1.91479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]