SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1A7WYL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A7WYL8
Domain Number 1 Region: 188-397
Classification Level Classification E-value
Superfamily MIR domain 1.31e-61
Family MIR domain 0.0000000219
Further Details:      
 
Domain Number 2 Region: 399-564
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 5.49e-59
Family IP3 receptor type 1 binding core, domain 2 0.0000000475
Further Details:      
 
Domain Number 3 Region: 1087-1243
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.96e-35
Family IP3 receptor type 1 binding core, domain 2 0.0066
Further Details:      
 
Domain Number 4 Region: 59-171
Classification Level Classification E-value
Superfamily MIR domain 1.96e-19
Family MIR domain 0.015
Further Details:      
 
Domain Number 5 Region: 1195-1303,1381-1649,1927-2109
Classification Level Classification E-value
Superfamily ARM repeat 0.0000127
Family PBS lyase HEAT-like repeat 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A7WYL8
Sequence length 2731
Comment (tr|A0A1A7WYL8|A0A1A7WYL8_9TELE) Inositol 1,4,5-trisphosphate receptor, type 1 {ECO:0000313|EMBL:SBP10654.1} OX=60296 OS=Aphyosemion striatum. GN=ITPR1 OC=Aphyosemion.
Sequence
PPKKFRDCLFKLCPMNRYSAQKQFWKAAKPGGNSTTDTVLLNKLHHAADLEKKQNESENR
KLLGTVIQYGNVIQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDSAGNEGSWFYIQPFYK
LRSLGDSVVIGDKVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKVVLFMKWSD
NKETILKGGDVVRLFHAEQEKFLTCDDHRKKQYVFLRTTGRQSATSATSSKALWEVEVVH
HDPCRGGAGYWNSLFRFKHLATGCYLAAEVNPDYEEENAEQRSAVVDFTPFNFQLDGDNE
ALRGRLRAPQEKIMYTLSPVPDGMDLSSIFELDPTTLRGGDSMVPRSSYVRLRHLRSGTW
VHSTNIPIDKEEEKPVMLRIGTSGIKEDKEAFAIVPVPPSEVRDLDFANDASKVLASIAG
KLEKGTITQNERRFVTKLLEDLVFFVVDIPNSGQDVLEIMVNKPNRERQKLMREQNILKQ
IFKLLQAPFTDSGDGPMLRLEELGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQF
RFMQKQIGYDVLAEDTITALLHNNRKLLEKHITAAEIDTFVTLVRKNREPRFLDYLSDLC
VSMNKSIPVTQELICNAVLDSSNSDILIETKLVLSRFEIEAGVNGEAPVEAEDEEEVWLF
WKDNCKEIRNKSVRELAQDAKEGQKEDQEVVSYYRCQLNLFARMCLDRQYLAINKISGQL
DVDLILRCMSDEDLPYDLRASFCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSQIAIDDY
DNDGTTRDEIKERFSLTMDFVENYLREVVSQNVPFSDKEKNKLTFEVVNLARNLIYFGFY
NFSDLLRLTKILLNILDCVHVSTVYHVNKIEKEGENKAGSNVMKSIHEVGELMTQVVLRG
GGLLPTTPTHQPEGEVVKTQAEPEREDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIF
KREFDENNPQGDNTTSPNGTNNITAQMPGNLDFENIEEQAEGIFGGSEENSPLDLDDHGG
RTFLRVLLHLTMHDYPPLVSGALHLLFRHFSQRQEVLMAFKQVQLLVTSQDVENYKQIKS
DLDQLRSIVEKSELWVYKRQGEDGMDGEPSESDNKKKGDSPGSDKKKSESTSSYNYRVVK
EILVRLSKLCVQEGSSGRKSKKQQQRLLRNMGAHSVVLELLQIPYEKGEDVQMQDIMKLA
HEFLQNFCAGNQQNQALLHKHINLFLNPGILEAVTMQHIFMNNFQLCSEISERVVQHFVH
CTETHGRHVQYLKFLQTIVKAENKFIKKCQDVVMAELVNSGEDVLVFYNDRASFQTLVQM
MRSERDRMDENSPLMYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPE
VKVAYINFLNHCYVDTEVEMKEIYTSNHMWKLFENFLVDICRVCNNTSDRKHADTMLERY
VTETVMGIVTCFFSSPFSDQSTSLQTRQPVFVQLLQGVFRVYHCSWLNPVQKASVEACIK
VLSDVAKSRAIAIPVDLDSQVNNLFVKSNNLVQKSILNWKLSTKNTSRRDSSLSGSKDYR
NIIERLQDIVSALEDRLRPLVQAELSVLVDVLHRPELLFPENTDARRKCESGGFISKLIK
HTKQLLEENEERLCIKVLQTLREMMTKDRGYGVKLIAFDDEMDVAELAPPPEPEVPAEEL
DPSQPLKQVEDQRRGEALRQVLVNRYYGNVKSGQRRESITTYGNGPLAPGAQGKSTTVVS
PGVGGRGELSLAEVQCHLDKEGASDLVIDLIMNATSDRIFQESILLAIALLEGGNTVIQR
SFYHRLTGDNKSEKFFKVFYERMKLAQQEIKATVTVNTSDLGNKKKDEEPPDKDVPARKK
AKDVPVVALVTEEVKEQLVEASAITKKAYTTYRREAEAEEHQAAADGTPVPTPDKNQDEG
EMSVIITIMQPILRLMQLLCENHNRDLQNFLRNQNNKNNYNLVCETLQFLDCICGSTTGG
LGLLGLYINEKNVGLINQTVESLTEYCQGPCHENQNCIATHECNGIDIIIALILNDINPL
GKKRMDLVLELKNNASKLLLAIMESRHDSENAERILYNMRPKELVEVIKKAYMQGEIEVE
EPEEGEDGEEEHSASPRNVGHNIYILAHQLARHNKELQAMLKPGGTYGEGDEALEFYAKH
TAQIEIVRLDRTMEQIVFPVPNICEFLTHESKLRVYYTTERDEQGSKINDFFLRSEDLFN
EMNWQKKLRGTQEATGNTNTVPSQPILYWCSRNMSFWSSISFNLAVLMNLLVAFFYPLEG
VRGGTLEPHLSALLWMAMLVSLAIVIVLPQPHGIRALIASTILRLIFSVGLEPTLFLLGA
FNLCNKVIFLMSFVGNRGTFTRGYTAMIMDVEFLYHLLYLIICTLGVFVHVFFYSLLLFD
LVYREETLLNVIKSVTRNGRSIVLTAVLALILVYLFSIVGYIFFKDDFILAVDRIPNKTL
EHGASMVGEFFSGGACRKESGENCSAEAVVDASVAVQPSVVIEDKERTCDSLLMCIVTVL
SHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSE
KQKKEEILKTTCFICGLERDKFDNKTVTFEEHIKVEHNMWHYLFFIVLVKVKDSTEFTGP
ESYVAEMIRDHNLDWFPRMRAMSLVSSDADGEQNEIRNLQEKLESTMKLVTNLTGQLTEL
KEQMTEQRKQKQRIGLLGHPQHMNVNPQQPA
Download sequence
Identical sequences A0A1A7WYL8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]