SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1A7ZM18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A7ZM18
Domain Number 1 Region: 238-433
Classification Level Classification E-value
Superfamily MIR domain 2.01e-64
Family MIR domain 0.0000000744
Further Details:      
 
Domain Number 2 Region: 435-602
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 4.58e-52
Family IP3 receptor type 1 binding core, domain 2 0.000000573
Further Details:      
 
Domain Number 3 Region: 1123-1265
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 3.53e-32
Family IP3 receptor type 1 binding core, domain 2 0.0069
Further Details:      
 
Domain Number 4 Region: 110-220
Classification Level Classification E-value
Superfamily MIR domain 2.49e-18
Family MIR domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A7ZM18
Sequence length 2669
Comment (tr|A0A1A7ZM18|A0A1A7ZM18_NOTFU) Inositol 1,4,5-triphosphate receptor, type 3 {ECO:0000313|EMBL:SBP43070.1} OX=105023 OS=Nothobranchius furzeri (Turquoise killifish). GN=ITPR3 OC=Nothobranchius.
Sequence
MSDSASSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKV
CPMSRYSAQKQYWKAKQAKHEKDKISDVVLLQKLQHASNLEQKQNETENKKVHGDVVKYG
NVLQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRANGDNVVV
GDKVILNPVNAGQPLHASNYELTDHPGCKEVNSVNCNTSWKINLFMMFSDHREDVLKGGD
VVRLFHAEQEKFLTCDEYKTKLHVFLRTTLRQSATSATSSNALWEIEVVHHDPCRGGAGH
WNSLYRFKHLATGSYLAAEENPGYKGDNVELSASMDGSRSNKRSQGERIKYKLVVVPHGN
DIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDVDEERPIRLMLGTCP
TKEDKEAFSIVSVPVMEIRDLDFANDASAMLATVVKQFNSGFICPNDRRFAIKLLEDVVF
FVADVVNSGQQVLDVVMTKPNRERQKLMREQNILKQIFGIIKAPFKDRGGGEGPLLRLEE
LMDQKNTLYKYMLRLCYRVLRHSQDDYRKNQEHIAKHFGVMQSQIGYDILAEDTITALLH
NNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNNVAIPVTQELICKCVLDPD
NQDILIKTERRVPKEAPHGGVQGDYTGMEDYGDEDEVWLVWSDRNKETQEKSIRQLSQEA
RQGNAHDENVLTYYRYQLKLFARMCLDRQYLAIHEISKQLDVELIFLCMMDESLPFDLRA
SFCRLMLHAHVDRDPQELVTPVKFARLWTEIPTSITIKDYDSNLDDSRDNKKNRFANTMA
FMEEYLNNVLNEELPFHNEEKNKLTYEVVSLARHLIYFGFYSFFELLRLTRTLLGIIDCR
PNLTQAGEMFPEEGSGKSVKRSIHGMGHMMTTMVLNRKQSMSGGAAGRGSGFVLEGPRDG
KDSLDKQDLVVMDTKLKILEILQFILNVRLDYRISFLLSVFKKEFVDVYPMAEADATTNM
EQAATINLQQIGEQAEAMFGVRKGNSILEVDDEGGRMFLRVLIHLTMHNYAPLVSGALQL
LFRHFSQRQEVLHTFKQVQLLISAQDVDNYKLIKADLDRLRTLVEKSELWVEKKGSGRGE
GKEKDEGAAEGKSPKEKLEKGNESYQNVKEILERLYKMCSTGVWKKQQRLLKNMGAHKVM
LDLLQVSYDKNDVKMQEIIRYTHQFLQKFCMGNQENQALLHKNLALFLNPGLLEAETVQH
IFNNNYQLCSEISESVLHHFIHCLATHGRHVQYLNFLHTIIKAEGKYVKKCQDMIMTELT
NAGEDVVIFYNDKTSFDVMLALMAESREGVGENSPLRYHISLVELLAACAEGKNVYTEIK
CTSLLPLEDAVRVVTHQDCITEVKIAYVNFVNHCYVDTEVEMKEIYTSNHIWKLFDDFTV
DMARVCNKREKRLSDPILEKYIINVVFDTITAFFSSPFSENSTSLQTHHTIVTQLLQSSI
RLLDCPWLQQQHRGQVETCIKTLSMTAKNRSIPLSLELEALIKNVLANSVQNSLNRSNPN
YKSMSRSARPIPSSNPWDYKNIIEKLQDIINTLEERLKPLVNAELSVLVDVLHQPELLFQ
EGTDVRQRCESGGFISKLIQHTKTLMSSEEKLCIKVLRTLQEMLIRTLDFDEKGISLRKV
LLQNYLFPNKKNNQKNELAELGAAGSEQERDWAMVAAVQCRLDREGGTKLFTDLVMSTKN
DKIFQESIQLAICLLEGGNTEIQNSFYKLMMGDNKSEKFFKVLDDRMKEAQMDIKATVSV
NVSEMTHKANEKELESGSAALVLPGSGGHPLLVQGQSVASALPAQPPPEQPEMEMGPAVT
IMKPILRFLQLLCENHNQNLQNFLRVQNNKTNYNLVCETLQFLDIMCGSTTGGLGLLGLY
INESNVHLIIQTLETLTEYCQGPCQENQTCIVTHESNGIDIITALILNDISPLSRYRMEM
VLQLKDNASKLLLALMESRHDNENAERILFNLRPRELVEVIKKAYLQDCECEEVEVSSRE
VGHNIYILAQQLARHNKFLQNLLKPQKKSPEGEEGISSMLNLNNRPLSQMLKSSAPVDVV
EQDPLEFYDQLTSQIEIVREDRSMEQIVFPVHPICEFLTEESKSRVFNTTEQDEQGSKVT
HFFEQTSFLHGEMEWQKKLRSMPVLYWFSRRMSLWGTISFNLAVFINLIIAFFYPYDSGQ
GAIDDSMLLMLFWILTGLSVLGLLSQRGLQPLTLALILRSIYHLGIGNTLILLGSLNLIN
KVVFVVSFVGNNGTFIMGYKAMVMDVEFLYHLAYVLTSTLGLFVHELFYSILLFDLIYRE
ETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKEDFIMEVDHLSQIAEAPGQS
EASQDFLSSCSSDGVSCTAEVGNRPEEDDEANTERACDTLLMCIVTVMNHGLRNGGGVGD
VLRKPSKNEPLFPARVVYDLLFYFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTC
FICGLERDKFDNKTVSFEEHIKLEHNIWNYLYFIVLVREKNKTDYTGPESYVAHMIKNNN
LDWFPRMQAMSLVVTDSDGEQNEMRMLQDKLASTMKVVMNLTTQLNDLKEQMTEQRKRKQ
RLGFQDVQVGASVAIPPTAAGGNHQIYKT
Download sequence
Identical sequences A0A1A7ZM18

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]