SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A7ZW81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A7ZW81
Domain Number 1 Region: 43-280
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.08e-57
Family Ankyrin repeat 0.0000642
Further Details:      
 
Domain Number 2 Region: 293-338
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000497
Family SOCS box-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A7ZW81
Sequence length 343
Comment (tr|A0A1A7ZW81|A0A1A7ZW81_NOTFU) Ankyrin repeat and SOCS box-containing 7 {ECO:0000313|EMBL:SBP47142.1} OX=105023 OS=Nothobranchius furzeri (Turquoise killifish). GN=ASB7 OC=Nothobranchius.
Sequence
VTLQRLTECSSKMTKRSSSLQLVKRMLNHHCRGNPDLHEELQIQAAVAAGDVCTVRRMLE
RGYSPQIRDANGWTLLHFSAAKGKERCVRVFLEHGADPRVKDFIGGFTALHYAAMHGRAR
IARLMLESDFCGDIINAKSNDGWTPLHVAAHYGRDSFVRLLLEFRAEVDPLSDKGTTPLQ
LAIIRERSSCVRILLDHSANIDIQNGFLLRYAVIKGNHSYCRMFLQRGADTNLGRLEDGQ
TPLHLSALRDDMLCAQMLYTYGANINIRNYEGQTPVAVSVSMSGISRPCLDFLQEVTRQP
RTLQDLCRIQIRRSIGLQSLKLLEDLPVAKVMKDYLQHKFDSL
Download sequence
Identical sequences A0A1A7ZW81

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]