SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8A0D9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8A0D9
Domain Number 1 Region: 4-147
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 3.36e-55
Family Crystallins/Ca-binding development proteins 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A8A0D9
Sequence length 151
Comment (tr|A0A1A8A0D9|A0A1A8A0D9_NOTFU) Crystallin, gamma N2 {ECO:0000313|EMBL:SBP48612.1} OX=105023 OS=Nothobranchius furzeri (Turquoise killifish). GN=CRYGN2 OC=Nothobranchius.
Sequence
WVFVFRVNSIRVESGAWICYDHPDFKGQQYILEHGEYPEFQRWNSHNDHMGSCKPIRMHG
EHYRIELFESCNFSGQCVEICDDCPFLQSRGFSKNCINSVRVYGDGAWVMYEEPNFRGRM
YIVERGNYCGPNEWQAQNPNIQSIRRVVNYF
Download sequence
Identical sequences A0A1A8A0D9 A0A1A8HUF9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]