SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8AS41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8AS41
Domain Number 1 Region: 1-143
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 1.93e-44
Family Crystallins/Ca-binding development proteins 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A8AS41
Sequence length 144
Comment (tr|A0A1A8AS41|A0A1A8AS41_NOTFU) Crystallin, beta A1a {ECO:0000313|EMBL:SBP57854.1} OX=105023 OS=Nothobranchius furzeri (Turquoise killifish). GN=CRYBA1A OC=Nothobranchius.
Sequence
AWAGYEHSSFCGQQFVLERGEYPHWESWSGSNAYHIERMMSFRPICSANHKESKMMLFEK
ENFMGSQWEINDDYPSLQAMGWGNNEIGSMQVQGGAWVCYQFPGYRGYQYIMECDRHGGE
YKHYREWGSHAQSFQVQSLRRIQQ
Download sequence
Identical sequences A0A1A8AS41

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]