SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1A8B4X0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8B4X0
Domain Number 1 Region: 236-448
Classification Level Classification E-value
Superfamily MIR domain 1.05e-61
Family MIR domain 0.0000000328
Further Details:      
 
Domain Number 2 Region: 450-615
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 5.62e-59
Family IP3 receptor type 1 binding core, domain 2 0.0000000475
Further Details:      
 
Domain Number 3 Region: 1138-1295
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 8.24e-36
Family IP3 receptor type 1 binding core, domain 2 0.007
Further Details:      
 
Domain Number 4 Region: 107-219
Classification Level Classification E-value
Superfamily MIR domain 1.27e-18
Family MIR domain 0.015
Further Details:      
 
Domain Number 5 Region: 1247-1355,1433-1701,1979-2161
Classification Level Classification E-value
Superfamily ARM repeat 0.0000046
Family PBS lyase HEAT-like repeat 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A8B4X0
Sequence length 2783
Comment (tr|A0A1A8B4X0|A0A1A8B4X0_NOTFU) Inositol 1,4,5-trisphosphate receptor, type 1 {ECO:0000313|EMBL:SBP61736.1} OX=105023 OS=Nothobranchius furzeri (Turquoise killifish). GN=ITPR1 OC=Nothobranchius.
Sequence
MSDKMSSFLHIGDICSLYAEGSTSGFISTLGLVDDRCVVQPESGDLSNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGGNSTTDTVLLNKLHHAADLEKKQNESENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDLAGNEGSWFYIQPFYKLRSLGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKVVLFMKWSDNKETILKGGDVV
RLFHAEQEKFLTCDDHRKKQYVFLRTTGRQSATSATSSKALWEVEVVHHDPCRGGAGYWN
SLFRFKHLATGCYLAAEVGEVNPDYEEENAEQRSAVVDFTPFNFQLDGDNEAPRGRLRAP
QEKIMYTLSPVPDGMDLSSIFELDPTTLRGGDSMVPRSSYVRLRHLCSGTWVHSTNIPID
KEEEKPVMLRIGTSGIKEDKEAFAIVPVPPSEVRDLDFANDASKVLASIAGKLEKGTITQ
NERRFVTKLLEDLVFFVVDIPNSGQDVLEIMVNKPNRERQKLMREQNILKQIFKLLQAPF
TDSGDGPMLRLEELGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFRFMQKQIGY
DVLAEDTITALLHNNRKLLEKHITAAEIDTFVTLVRKNREPRFLDYLSDLCVSMNKSIPV
TQELICNAVLDSSNSDILIETKLVLSRFEIEAGVNGEAPVEAEDEEEVWLFWKDNCKEIR
NKSVRELAQDAREGQKEDQEVVSYYRCQLNLFARMCLDRQYLAINKISGQLDVDLILRCM
SDEDLPYDLRASFCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSQIAIDDYDNDGTTRDE
IKERFSLTMDFVENYLREVVSQNVPFSGKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLT
KILLNILDCVHVSTVYPINKIEKEDENKAGSNVMKSIHEVGELMTQVVLRGGGLLPTTPT
HQPEGEVVKTQAEPEREDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDENNP
QRDTTTSANGTNNVTAQMPGNLDFENIEEQAEGIFGGSEENSPLDLDDHGGRTFLRVLLH
LTMHDYPPLVSGALHLLFRHFSQRQEVLMAFKQVQLLVTSQDVENYKQIKSDLDQLRSIV
EKSELWVYKRQGEDGMDGDGPSESDNKKKGDSPGSDRKTSESTSSYNYRVVKEILVRLSK
LCVQEGSSGRKCKKQQQRLLRNMGAHSVVLELLQIPYEKGEDVQMQDIMKLAHEFLQNFC
AGNQQNQALLHKHINLFLNPGILEAVTMQHIFMNNFQLCSEISERVVQHFVHCTETHGRH
VQYLKFLQTIVKAENKFIKKCQDIVMAELVNSGEDVLVFYNDRASFQTLVQMMRSERDRM
DESSPLMYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINF
LNHCYVDTEVEMKEIYTSNHMWKLFENFLVDICRVCNNTSDRKHADTMLERYVTETIMSI
VTCFFSSPFSDQSTSLQTRQPVFVQLLQGVFRVYHCSWLNPVQKASVEACIKVLSDVAKS
RAIAIPVDLDSQVNNLFVKSNNLVQKSILNWKLSTKNTSRQDSSLSGSKDYRNIIERLQD
IVSALEDRLRPLVQAELSVLVDVLHRPELLFPENTDARRKCESGGFISKLIKHTKQLLEE
NEERLCIKVLQTLREMMTKDRGYGVKLIAFDDETDVAELAPPPEPDVPAEELDPNQPLKQ
VEDQRRGEALRQILVNRYYGNVKSGQRRESITTYSNGPLAPGAQGKSITVVSPGVGGRGE
LSLAEVQCHLDKEGASDLVIDLIMNATSDRIFQESILLAIALLEGGNTVIQLSFYHRLTG
DNKSEKFFKVFYERMKLAQQEIKATVTVNTSDLGNKKKDEEPPDKDLPARKKAKDVPAVA
LVTEEVKEQLVEASAITKKAYTTYRREAEAEEQQAAAEGSPIPTPDKNQDEGEMSVIITI
MQPILRLMQLLCENHNRDLQNFLRNQNNKNNFNLVCETLQFLDCICGSTTGGLGLLGLYI
NEKNVGLINQTVESLTEYCQGPCHENQNCIATHECNGIDIIIALILNDINPLGKKRMDLV
LELKNNASKLLLAIMESRHDSENAERILYNMRPKELVEVIKKAYMQGEIEVEEPEEGEDK
EEEHSASPRNVGHNIYILAHQLARHNKELQVMLKPGGTYGEGDEALEFYAKHTAQIEIVR
LDRTMEQIVFPVPNICEFLTQESKLRVYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKL
RGSQEATGNTNTVPSQPVLYWCSRNMSFWSSISFNLAVLMNLLVAFFYPLEGFRGGTLEP
HLSALLWMAMLVSLAIVIVLPQPHGIRALIASTILRLIFSVGLEPTLFLLGSFNLCNKVI
FLMSFVGNRGTFTRGYIAMIMDVEFLYHLLYLIICTLGVFVHVFFYSLLLFDLVYREETL
LNVIKSVTRNGRSIVLTAVLALILVYLFSIVGYIFFKDDFILAVDRIPNKTLEHGASMVG
ELFSGGACQKESGENCSAEAVVEASVAVQPSVVIEDKERTCDSLLMCIVTVLSHGLRSGG
GVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEIL
KTTCFICGLERDKFDNKTVTFEEHIKVEHNMWHYLFFIVLVKVKDSTEFTGPESYVAEMI
RDHNLDWFPRMRAMSLVSSDADGEQNEIRNLQEKLESTMKLVTNLSGQLTELKEQMTEQR
KQKQRIGLLGHPQHMNVNPQQPA
Download sequence
Identical sequences A0A1A8B4X0
XP_015815390.1.37898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]