SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8BT24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8BT24
Domain Number 1 Region: 27-208
Classification Level Classification E-value
Superfamily TIMP-like 3.14e-75
Family Tissue inhibitor of metalloproteinases, TIMP 0.0000000649
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A8BT24
Sequence length 220
Comment (tr|A0A1A8BT24|A0A1A8BT24_9TELE) Tissue inhibitor of metalloproteinase 2a {ECO:0000313|EMBL:SBP70817.1} OX=1051664 OS=Nothobranchius kadleci. GN=TIMP2A OC=Nothobranchius.
Sequence
MPFSVNGILCALALLLLWRAEELVEACSCAPVHPQQAFCNADVVIRAKVVGESEVDSGND
IYGNPIKRIQYDVKQIKMFKGPNQDIEAVFTAPVSAVCGVTLDASGKKEYLISGKAEAGG
RMHVTLCDYIMPWDSLSATQKKSLSQRYQMGCDCKIVRCPSLPCEITAPEECLWTDLIIE
KQVHGRQANHYACVKRADGSCSWYRGVAPPKKEFLDAEDP
Download sequence
Identical sequences A0A1A8B097 A0A1A8BT24 A0A1A8QP48
XP_015818347.1.37898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]