SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1A8FNE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8FNE2
Domain Number 1 Region: 412-577
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 3.4e-53
Family IP3 receptor type 1 binding core, domain 2 0.000000368
Further Details:      
 
Domain Number 2 Region: 222-410
Classification Level Classification E-value
Superfamily MIR domain 8.63e-52
Family MIR domain 0.000000232
Further Details:      
 
Domain Number 3 Region: 1063-1182
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 7.85e-30
Family IP3 receptor type 1 binding core, domain 2 0.012
Further Details:      
 
Domain Number 4 Region: 137-174
Classification Level Classification E-value
Superfamily MIR domain 0.000017
Family MIR domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A8FNE2
Sequence length 1824
Comment (tr|A0A1A8FNE2|A0A1A8FNE2_9TELE) Inositol 1,4,5-triphosphate receptor, type 2 {ECO:0000313|EMBL:SBQ60373.1} OX=1143690 OS=Nothobranchius korthausae. GN=ITPR2 OC=Nothobranchius.
Sequence
ERVDFLSRGEEECHLVINGRAELIYSSSPVRMADHLHIGDIVSLYAEGSVNGFISTLGLV
DDRCVVEPAAGDLDNPPKKFRDCLFKVCPMSRYSAQKQYWKAKQAKHEKDKISDVVLLQK
LQHASNLEQKQNETENKKVHGDVVKYGNVLQLLHMKSNKYLTVNKRLPALLEKNAMRPLH
ASNYELTDHPGCKEVNSVNCNTSWKINLFMMFSDHREEVLKGGDVVRLFHAEQEKFLTCD
EYKTKLHVFLRTTLRQSATSATSSNALWRGGAGQWNSVFRFKHLATGNYLAAEKNPEFKD
DTAQIEGENETDTMHSKRKNQAAEKIGFILISIPHGNDIASLFELDATTLQRSDCLVPRN
SYVRLRNLCTNTWVTSTNVPIDVEEERPVMLKIGTTSTREDKEAFSIVSVPLSEVRDLDF
ANDANKVLESTVRKLKHALITQNERRFLTKLLEDLVFFVCVEPNNGQDVLSVVTSTPNRE
RQKLMREQNILAQVFGILTAPFDETGDGPMLKLNDLGDHRNSHFKYIMRLCYRVLRHSQQ
DYRKNQEYIAKKFSIMQSQIGYEILAEDTITALLHNNRKLLEKHITAKEIETFVNLLRRN
REPRFLDYLSDLCVSNKSAIPVIQELICKFMLNPINADILIQTKLIPNTDTAVLLTEEEE
EEEVWLYWIDINKEPHGKSIRHLAQDAKGNHRDDIDIITYYRYQLDLFAKMCLDRQYLAI
NQISSQLPVDLILRCMFDECLPYNLRASFCRLMLHMHVDRDPQESVVPIRYARLWNEIPS
KITIADFVFRELLGLTRTLLAILDIIIQPPPFVNRLGKSPDAGNNVLRTIHGVGEMMTQM
VMSRGVPHNMSDSPPTLRYKKGHFLPINEDVMVMDTKLKIIEILQFILSVRLDYRITHLL
SMYKTQFDEMTQQDNSLAEMPSFTSSYEPRVDEIAAKAESMFAGSSELNTVELDDEGGRT
FLRVLLYLIMQDYPPLVSGSLQLIFKHFSQRDEVLQAFKQVQLLVSENDIENYKQIKKDL
DQLRLTVEKSELWVEKSGGYSNEDPEAGQGKEPNMEEGILSPVQDGYNKPQIDSNKENNY
TIVKEILARLIKLCNPGKKFRLQQQRLLKNMGAHLVVLDLLQIPYQKPDEKMKGIMAQAH
QFLQNFCQANPQNQVLLHKYLNLFLTPGLLEAETMRQIFMNNFQLCSEISDRVIHHFVHC
IATHGRHVQYLRFLQTIVKVDGKYVKKCQDKVMTELVTAGEDVLVFYNDRSSFPVLLQLM
ASEQERSDPNGALAYHNTLVDLMAACTEGKNVFTELKCNSLLPLDDIVKVVTDVNCIPEV
KMTYVNFVNHCYVDTEVEMKEIYTSPHMWSLFDNFLVDMATMCNTTTDRNHADQALEKYV
MESVMAFIKGFFHMPFCVNNSSQQINNSVFIKLIQSCFRIYNCTWLSPSQKTLVEICINT
LAEVAKTLNIAIPVDLDGQVTTMSLKVHTNVVQRAAKDWRTSARRPRKEPLGGLDYKIIE
NLQLVVCCLEKQISPKIQAEFSVLVDVLHSPELLFPEAARLRCDSETFMTTLIKHTKSLM
DKEEKLCIKILQTLRKMLHKREPFQESEMELRKILLTRYFGNQKLFSKPELGSGNSSSGA
FVKPSSGGSAVLDADKQVMDEVEIQSLLDKVGATELVINLVVNTKNDMVFEESILLGTAL
LQKGNTQIQYSFYNLLHKQKNSEKFFKVFYDRMGLAQQEIRAAMTSNALEFNVRSMDDDE
GPSSSRIRKNKDQGLQMRENMQGQLKEASAATSKAFVTYRIEVESDVMGLGQSDLVALDD
EKEDVLMNPSISIMNPILRFLQLL
Download sequence
Identical sequences A0A1A8FNE2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]