SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8FT72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8FT72
Domain Number 1 Region: 85-214
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.27e-23
Family WD40-repeat 0.0054
Further Details:      
 
Domain Number 2 Region: 1-56
Classification Level Classification E-value
Superfamily BEACH domain 7.72e-16
Family BEACH domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A8FT72
Sequence length 226
Comment (tr|A0A1A8FT72|A0A1A8FT72_9TELE) Neurobeachin-like 2 {ECO:0000313|EMBL:SBQ62595.1} OX=1143690 OS=Nothobranchius korthausae. GN=NBEAL2 OC=Nothobranchius.
Sequence
RGEEAVEALNVFYYCTYEGAVDLDAIANENERKALEGIISNFGQTPCQLLKEPHPPHLTM
TNPKTQRFLGGPFSPGVEIGAQVLVVSNDGRLLFSGGHWDCSLRVTQLGKGKLVGRICRH
IDIVTCLALDLCGIYLISGSRDTSCIVWQVLQQEGFSCGLSPRPMQILCGHDQEITCVAI
NTELDMAVSGSKDGTVIVHTIRQGHFIRTLHASGDSRIPAKISGLQ
Download sequence
Identical sequences A0A1A8FT72

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]