SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8GY21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8GY21
Domain Number 1 Region: 39-154
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 6.28e-39
Family Frizzled cysteine-rich domain 0.0000464
Further Details:      
 
Domain Number 2 Region: 172-278
Classification Level Classification E-value
Superfamily TIMP-like 0.000000000235
Family Tissue inhibitor of metalloproteinases, TIMP 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A8GY21
Sequence length 295
Comment (tr|A0A1A8GY21|A0A1A8GY21_9TELE) Secreted frizzled-related protein 2 {ECO:0000313|EMBL:SBQ76133.1} OX=1143690 OS=Nothobranchius korthausae. GN=SFRP2 OC=Nothobranchius.
Sequence
MRGFIFTVTVLWMISASCAEAIHGLYNFGQHDLFHKKNNCKQIPSSLLLCHDIEYTEMRL
PNLLGHESMNEVLQQASSWIPLIQKQCHPDTRKFLCSLFAPVCLDDLDEPIQPCRSLCES
VKRGCAPVMYAFGYPWPDMLNCDRFPLDNDLCIPPASVENVVPVTKEVPRVCDACKETEE
NDNEIVDNLCKNDFALKIKVKEISYINGDTKVVPETKSKTIYMMNGVNERDLRKTVLWLR
DGQKCICEEMNDINAAYLVVGQKIDGRLVITSLKRWQKGQREFKRITRSIRKIQC
Download sequence
Identical sequences A0A1A8GY21

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]