SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8HI09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8HI09
Domain Number 1 Region: 6-113
Classification Level Classification E-value
Superfamily PH domain-like 1.54e-30
Family PreBEACH PH-like domain 0.00000436
Further Details:      
 
Domain Number 2 Region: 120-156
Classification Level Classification E-value
Superfamily BEACH domain 0.000000222
Family BEACH domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A8HI09
Sequence length 156
Comment (tr|A0A1A8HI09|A0A1A8HI09_9TELE) Uncharacterized protein {ECO:0000313|EMBL:SBQ83865.1} OX=1143690 OS=Nothobranchius korthausae. GN=BX530409.1 OC=Nothobranchius.
Sequence
DNLGGPVVLNSSAQLVAPALVARGTLSITTSEIYFEVDEDDPAFKRVDSKVLAYTEGLHG
KWMFSEIRAVFSRRYLLQNTALEVFMANRTSVMFNFPDQATVKKVVYCLPRVGVGTSYGL
PQARRISLATSRQLFTSSNMTQRWQRREISNFEYLM
Download sequence
Identical sequences A0A1A8HI09

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]