SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1A8HLW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8HLW9
Domain Number 1 Region: 3-264
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.19e-96
Family Capz beta-1 subunit 0.00000000053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A8HLW9
Sequence length 272
Comment (tr|A0A1A8HLW9|A0A1A8HLW9_9TELE) Capping protein (Actin filament) muscle Z-line, beta {ECO:0000313|EMBL:SBQ84431.1} OX=1143690 OS=Nothobranchius korthausae. GN=CAPZB OC=Nothobranchius.
Sequence
MNDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYEPPIEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTT
KTGSGTMNLGGSLTRQMEKDETVGESSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIV
NGLRSVQPQADRSQKEALKNDLVKALKLKQNP
Download sequence
Identical sequences A0A1A7X989 A0A1A8EL11 A0A1A8HLW9 A0A1A8J1E3 A0A1A8NRG0 A0A1A8PAY4 A0A1A8VBA5
XP_015815363.1.37898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]