SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8JP55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8JP55
Domain Number 1 Region: 1-63
Classification Level Classification E-value
Superfamily BEACH domain 9.94e-22
Family BEACH domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A8JP55
Sequence length 71
Comment (tr|A0A1A8JP55|A0A1A8JP55_NOTKU) WD repeat domain 81 {ECO:0000313|EMBL:SBR21851.1} OX=321403 OS=Nothobranchius kuhntae (Beira killifish). GN=WDR81 OC=Nothobranchius.
Sequence
RHLLESREVSQHLHHWIDLTFGYKLSGKDAVKAKNVCLHLVDNHTNLTSYGVVQLFDQPH
PPRLSPCQYAP
Download sequence
Identical sequences A0A1A8JP55

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]