SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1A8N5V7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8N5V7
Domain Number 1 Region: 8-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.28e-112
Family Capz alpha-1 subunit 0.000000000839
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A8N5V7
Sequence length 286
Comment (tr|A0A1A8N5V7|A0A1A8N5V7_9TELE) Capping protein (Actin filament) muscle Z-line, alpha 1b {ECO:0000313|EMBL:SBR64463.1} OX=451742 OS=Nothobranchius rachovii (bluefin notho). GN=CAPZA1B OC=Nothobranchius.
Sequence
MADFEEPLSDEEKVRIAANFVTHAPPGEFNEVFNDVRLLLNNDNLLREEASHSFAQYNMD
QFTPAKVEGYDEPVLITEHGDLGQGRFLDPRNHLSFRFDHLRKDVSDVQPYEGDEALRSW
RDACDTALSAYVKEHYPTGVCTVYEKTVDGQQTVIACIEGHQFQPKNFWNGRCRSEWKLT
LGQSTAHVVGVLKIQVHYYEDGNVQLVSHKEIEDSIPVTNEIQTAKEFIDIIESAENEYQ
TAINENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences A0A1A8N5V7 A0A1A8QYI2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]