SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8SCP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8SCP6
Domain Number 1 Region: 36-265
Classification Level Classification E-value
Superfamily 14-3-3 protein 1.28e-97
Family 14-3-3 protein 0.0000000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A8SCP6
Sequence length 288
Comment (tr|A0A1A8SCP6|A0A1A8SCP6_9TELE) Uncharacterized protein {ECO:0000313|EMBL:SBS16106.1} OX=451742 OS=Nothobranchius rachovii (bluefin notho). GN=Nfu_g_1_004152 OC=Nothobranchius.
Sequence
VDERERSSAEQSRGTFFDTTPDHQERHRLTTLAEAMADKAELVQKAKLAEQAERYDDMAA
AMKAVTEEGSELNNEERNLLSVAYKNVVGARRSSWRVVSSIEAKTDSSKTPLTKEYREKI
EAELNDICKEVLDLLDKHLIPKATPADSKVFYLKMKGDYYRYLAEVATEDSKEAIISSSQ
EAYQNALDISIKEMQPTHPIRLGLALNFSVFYYEIVNSPDKACQLAKSAFDEAIGMLDSL
NSDSYKDSTLIMQLLRDNLTLWMSDAQGEGEGEGEGEAEETEQAAEKN
Download sequence
Identical sequences A0A1A8SCP6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]