SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1A8WM82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8WM82
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.000000000000405
Family Capz alpha-1 subunit 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A8WM82
Sequence length 77
Comment (tr|A0A1A8WM82|A0A1A8WM82_PLAMA) F-actin-capping protein subunit alpha, putative (CPalpha) {ECO:0000313|EMBL:SBS94028.1} KW=Complete proteome; Reference proteome OX=5858 OS=Plasmodium malariae. GN=PMALA_041790 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
IKTLFGSSATIQNSIEDAISNYNEKNFVIICEQSKINNSYVHPKLKILATVNHLKRKVTG
TTELKELNYPQELESYR
Download sequence
Identical sequences A0A1A8WM82

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]