SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1A8YYX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8YYX8
Domain Number 1 Region: 3-249
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.88e-54
Family Capz beta-1 subunit 0.0000394
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A8YYX8
Sequence length 301
Comment (tr|A0A1A8YYX8|A0A1A8YYX8_9APIC) F-actin-capping protein subunit beta, putative (CPbeta) {ECO:0000313|EMBL:SBT36670.1} KW=Complete proteome; Reference proteome OX=864142 OS=Plasmodium ovale wallikeri. GN=POVWA1_031610 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MEEAKVEAALDICNILPAHLFEETIKILSKIDQNLTNKILVNKEGPIKIKFDSEEKKYFL
GNMFNKEKDSYRSPYTNMYYPDHLPHSYIPSEPLRSLEILYNEIFDRYRKAYYINGLSSV
YLWPNPVEDGFVACFLIKKNEKYDQYTYLDWEGTHLIQVNLTHLVVHYQISSTLNISIRR
KNEIILSASINKALENPKKISHINLIKDKYFHMENMGKMIEGIENSLRKSIEYIYLPKMN
GILNSLRYNDYMDITQYGHNGTQLQHISNGLTFQKGDVQDELREKLKSKNLSAGKEYLLN
T
Download sequence
Identical sequences A0A1A8YYX8 A0A1C3KIR9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]