SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A9CK67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A9CK67
Domain Number 1 Region: 4-73
Classification Level Classification E-value
Superfamily Barstar-related 0.0000000000000107
Family Barstar-related 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A9CK67
Sequence length 129
Comment (tr|A0A1A9CK67|A0A1A9CK67_9ACTN) Barstar, RNAse (Barnase) inhibitor {ECO:0000313|EMBL:SBU92215.1} KW=Complete proteome OX=1115570 OS=Streptomyces sp. OspMP-M45. GN=YUMDRAFT_04231 OC=Streptomyces.
Sequence
MTVTYVIEGSEVTGLERFWDLIGEAVNGPGGYFGRNLDAFADCLGGGFGTPADGSYVIEW
RDHEASARALGHEETARRLEGLLGRAHPTNRARVERELAEARAGRGPTLFDQLAGIIEDR
AGPGTLLLR
Download sequence
Identical sequences A0A069K070 A0A1A9CK67
WP_028442603.1.101174 WP_028442603.1.260 WP_028442603.1.46143 WP_028442603.1.58104 WP_028442603.1.66424 WP_028442603.1.7070 WP_028442603.1.77934 WP_028442603.1.85736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]