SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A9FGG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A9FGG6
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily Barstar-related 4.58e-29
Family Barstar-related 0.0000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A9FGG6
Sequence length 90
Comment (tr|A0A1A9FGG6|A0A1A9FGG6_LELAM) Uncharacterized protein {ECO:0000313|EMBL:ANG94402.1} KW=Complete proteome OX=61646 OS=Lelliottia amnigena (Enterobacter amnigenus). GN=A8A57_19100 OC=Enterobacteriaceae; Lelliottia.
Sequence
MNIYTFDFDEIDSQEDFYREFTRLFALERDRVTNLDSLWDVVTGDVLPLPLEIEFIHLPD
KLRRRFGALILLFDEAEEELEGQLRFNARQ
Download sequence
Identical sequences A0A1A9FGG6
WP_064327632.1.3558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]