SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A9FP49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1A9FP49
Domain Number - Region: 62-98
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 0.0408
Family Bcl-2 inhibitors of programmed cell death 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A9FP49
Sequence length 123
Comment (tr|A0A1A9FP49|A0A1A9FP49_9RHIZ) Uncharacterized protein {ECO:0000313|EMBL:ANG97600.1} KW=Complete proteome; Reference proteome OX=419475 OS=Ochrobactrum pseudogrignonense. GN=A8A54_14620 OC=Brucellaceae; Ochrobactrum.
Sequence
MMETMLNTQQWLPVELLNIGLAAAVFFACLVLSLWKAVFDELNPVFWRRTAAVLWAGVVI
VALSTGIESFNWPQIVGWVMVAGGVIATATRMGMSYYRQYSAHNVRRAKFTNPRFSGPRA
TGR
Download sequence
Identical sequences A0A1A9FP49
WP_007879469.1.27348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]