SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B0ANS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B0ANS8
Domain Number 1 Region: 156-239
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 3.71e-24
Family SWIB/MDM2 domain 0.0016
Further Details:      
 
Domain Number 2 Region: 7-58
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.0000000000418
Family DEK C-terminal domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B0ANS8
Sequence length 239
Comment (tr|A0A1B0ANS8|A0A1B0ANS8_9MUSC) Uncharacterized protein {ECO:0000313|VectorBase:GPPI003235-PA} KW=Complete proteome; Reference proteome OX=67801 OS=Glossina palpalis gambiensis. GN= OC=Hippoboscoidea; Glossinidae; Glossina.
Sequence
MADISIEELKNEIHAILKTADLSVISAKKVREQVEKKLECSLLSRKKEFDKIVMDFINSQ
QDDEGSGNDKDDDDDASGSDEEEDDDDASSEDEKKNTKKRAQPTQRKAPAKKKRKSLNAS
DSGTESDGGSDSDYEVPKKKATAKKKKSSANKEGSSGRKSTGFTRSYNLSPELSALMGAD
ALPRHEVVKKVWAIIKERNLYDPKNKQFAICDDELMKVMKVKRFRTFGMLKHLKPHFLE
Download sequence
Identical sequences A0A1A9XQX2 A0A1B0ANS8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]