SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B0G704 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B0G704
Domain Number 1 Region: 148-252
Classification Level Classification E-value
Superfamily ERP29 C domain-like 7.06e-25
Family ERP29 C domain-like 0.0000498
Further Details:      
 
Domain Number 2 Region: 26-144
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.22e-17
Family ERP29 N domain-like 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B0G704
Sequence length 253
Comment (tr|A0A1B0G704|A0A1B0G704_GLOMM) Windbeutel {ECO:0000313|VectorBase:GMOY009097-PA} KW=Complete proteome; Reference proteome OX=37546 OS=Glossina morsitans morsitans (Savannah tsetse fly). GN= OC=Hippoboscoidea; Glossinidae; Glossina.
Sequence
MSTLLYFVFIFIALPYHVVMSSSCMGCVDLDELNFDKTIRRFPYALVKFDIAFPYGDKHE
AFASFSKAAHAVTDDMLIATVGIKDYGDRDNLKLGERYKVDDKNYPAILLFQKDDENNYV
QFPSYLDITEDNLKSFVNSHTELYIGREGCSRELNDLAKNFVNLSEEDQRKRLKAAEELQ
EKLTNELDKQNANIYKIYMEKIQSKGYSFVEDETKRLARLKAGKVTELKRSELAIKLNIL
EAFHVNKLTKEEL
Download sequence
Identical sequences A0A1B0G704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]