SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B0VD53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B0VD53
Domain Number 1 Region: 36-203,266-285
Classification Level Classification E-value
Superfamily Cytochrome f, large domain 8.5e-96
Family Cytochrome f, large domain 0.0000000154
Further Details:      
 
Domain Number 2 Region: 203-265
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 3.45e-20
Family Cytochrome f, small domain 0.0000681
Further Details:      
 
Domain Number 3 Region: 282-320
Classification Level Classification E-value
Superfamily Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 3.53e-16
Family Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B0VD53
Sequence length 320
Comment (tr|A0A1B0VD53|A0A1B0VD53_PERFR) Cytochrome f {ECO:0000256|HAMAP-Rule:MF_00610} OX=179837 OS=Perilla frutescens var. crispa. GN=petA OC=Elsholtzieae; Perilla.
Sequence
MQTRNTFSWIKEHITRSISVSLMIYIITRTSVSSAYPIFAQQGYENPREATGRIVCANCH
LANKPVDIEVPQAVLPDTVFEAVVRIPYDKQVKQVLANGKKGGLNVGAVLILPEGFELAP
SDRISPEMKEKIGNLSFQSYRPNKKNILVIGPVPGQKYSEITFPILSPDPTTKKDAHFLK
YPIYVGGNRGRGQIYPDGSKSNNTVYNATGAGIVSKIIRKEKGGYEITITDPSDGRQVVD
IIPPGPEVLVSEGESIKLDQPLTSNPNVGGFGQGDAEIVLQDPLRVQGLLVFLASVILAQ
IFLVLKKKQFEKVQLAEMNF
Download sequence
Identical sequences A0A1B0V989 A0A1B0VAK5 A0A1B0VAS9 A0A1B0VC76 A0A1B0VD53 A0A1B0VD68 A0A1B0VDD5 A0A1B0VEC3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]