SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B1L3X1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B1L3X1
Domain Number 1 Region: 22-176
Classification Level Classification E-value
Superfamily TIMP-like 7.46e-28
Family Tissue inhibitor of metalloproteinases, TIMP 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B1L3X1
Sequence length 178
Comment (tr|A0A1B1L3X1|A0A1B1L3X1_BACTU) CbiN domain protein {ECO:0000313|EMBL:ANS47395.1} KW=Complete proteome OX=1428 OS=Bacillus thuringiensis. GN=BT246_20150 OC=Bacillus cereus group.
Sequence
MFPVVIICSFILIIFPEKSYACDCIKVSTEAAFQKNDVVFEGKVIEVGRKEEVGTEVLFE
VKKIWKGTTSSQIIVYTKGGDCMFRFVEGGGYLVFSTQRGSEKQLHTNSCSGTKRLDEAG
ADKAALSQIAKESVPTKKVDLKGEMVSGLNWRQVAIISIGLLLMIVFVIFIVRKTRKK
Download sequence
Identical sequences A0A1B1L3X1 R8U8A8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]