SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B1N0Q7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B1N0Q7
Domain Number 1 Region: 10-84
Classification Level Classification E-value
Superfamily EF2458-like 1.44e-29
Family EF2458-like 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B1N0Q7
Sequence length 103
Comment (tr|A0A1B1N0Q7|A0A1B1N0Q7_9BACL) UPF0358 protein AWM70_10720 {ECO:0000256|HAMAP-Rule:MF_01560} KW=Complete proteome; Reference proteome OX=1462996 OS=Paenibacillus yonginensis. GN=AWM70_10720 OC=Paenibacillus.
Sequence
MTSSDLQEQLNLKALNLLQEDAYKIEKLIEVQMENLATRYCPLYEEVLDTQMFGFSKEVD
FAVRAGLVNELVGKQILSKLERNLALLYEALNQKANQSEDGTL
Download sequence
Identical sequences A0A1B1N0Q7
WP_068696252.1.57690 WP_068696252.1.9958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]