SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B2A628 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B2A628
Domain Number 1 Region: 2-68
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 9.03e-18
Family Steroid-binding domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B2A628
Sequence length 79
Comment (tr|A0A1B2A628|A0A1B2A628_LACCU) Steroid-binding protein {ECO:0000313|EMBL:ANY13489.1} KW=Complete proteome OX=28038 OS=Lactobacillus curvatus. GN=BCY75_05595 OC=Lactobacillus.
Sequence
MTDKVFTKETLAQYNGQDGQPAYVAVDGVVYDLSAIAPWQGGKHFKGLTAGRDLSEFFAK
SHHTPATLKQAVQVGTYQA
Download sequence
Identical sequences A0A0R1LCH9 A0A1B2A628 G6CGC5
WP_004270892.1.302 WP_004270892.1.48807 WP_004270892.1.72498 WP_004270892.1.73773 WP_004270892.1.82145 WP_004270892.1.93478 WP_004270892.1.9365 WP_004270892.1.97063 WP_004270892.1.98391 WP_004270892.1.9963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]