SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B2DT43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B2DT43
Domain Number 1 Region: 4-242
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.07e-78
Family LplA-like 0.000000853
Further Details:      
 
Domain Number 2 Region: 243-331
Classification Level Classification E-value
Superfamily SufE/NifU 6.8e-20
Family SP1160 C-terminal domain-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B2DT43
Sequence length 331
Comment (tr|A0A1B2DT43|A0A1B2DT43_9BACL) Lipoate--protein ligase {ECO:0000256|SAAS:SAAS00603724} KW=Complete proteome OX=1870819 OS=Paenibacillus sp. BIHB4019. GN=BBD42_20355 OC=Paenibacillus.
Sequence
MRFVSNNHITDPALNLALEEYILRSLPPEDDYLLFYINEPSIIIGKNQNTLEEINPRYVE
ENNIHVVRRLSGGGAVYHDEGNLNFSFIMSDDGQSFHNFKKFTEPVVKALAALGVQAELT
GRNDIQVGERKISGNAQFSGRGRMFSHGTLLFDSEIENVVSALKANPEKYVSKATKSIRS
RVANISEFLSEPITIEEFRQSVLASIFEGSEEIPYYELSEAQWADVRELAQTRYRSWDWN
YGRSPAFNMRQTKRIEGAGTFDVRLQVEEGLIADAAVYGDFFGRGESSEFAKQLIGQRYD
AAALGKLLGEIDLSYYFGKVTKEDLMGLIFE
Download sequence
Identical sequences A0A1B2DT43

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]