SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B3DDJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B3DDJ0
Domain Number 1 Region: 142-233
Classification Level Classification E-value
Superfamily V-type ATPase subunit E-like 0.00000353
Family V-type ATPase subunit E 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B3DDJ0
Sequence length 254
Comment (tr|A0A1B3DDJ0|A0A1B3DDJ0_PSEFL) Flagellar assembly protein FliH {ECO:0000313|EMBL:AOE69336.1} KW=Complete proteome OX=294 OS=Pseudomonas fluorescens. GN=A7317_20785 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSSKDETPSDLIRARDVGGFDIWSLPSFDPHVPEPEPEPVEELPAEMEEVPLEEVQPLTL
EELESIRQEAYNEGFAAGEKDGFRSTTLKVRQEAEAALSVKLTSLERLMGSLFDPIAEQD
SQIEKAMVGLVQHIARQVIQRELALDSSQIEGVMREALKLLPLGVGNVRLYINPQDFEQV
KALRERHEETWRIVEDAALLPGGCRVETEHSRIDATVETRISQIMAKLFDQLHEQALHPA
EPDLSVELDASDAP
Download sequence
Identical sequences A0A1B3DDJ0 A0A1H3U1M1 V9R0R1
WP_024076713.1.30104 WP_024076713.1.33002 WP_024076713.1.9252 WP_024076713.1.96783 gi|568141537|ref|YP_008934122.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]