SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B3PNR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B3PNR4
Domain Number 1 Region: 80-147
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 1.83e-30
Family Cyanase C-terminal domain 0.00013
Further Details:      
 
Domain Number 2 Region: 1-77
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.89e-20
Family Cyanase N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B3PNR4
Sequence length 147
Comment (tr|A0A1B3PNR4|A0A1B3PNR4_9BURK) Cyanate lyase {ECO:0000256|HAMAP-Rule:MF_00535} KW=Complete proteome; Reference proteome OX=1842533 OS=Acidovorax sp. RAC01. GN=BSY15_1956 OC=Comamonadaceae; Acidovorax.
Sequence
MNRNDVTEKIISTKVAKGLQWDAIAKKVGQSKEWTTALCLGQMTATAEQAKMLGKIFGLT
AEEQKWLQVVPYKGSLPTPVPTDPLIYRWYEIVSVYGTTIKELIHEEFGDGIMSAIDFSM
DIQREANPNGDRVNVVLSGKFLPYKQY
Download sequence
Identical sequences A0A1B3PNR4
WP_069104629.1.1177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]