SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B4SJS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B4SJS4
Domain Number 1 Region: 82-208
Classification Level Classification E-value
Superfamily NosL/MerB-like 1.99e-35
Family MerB-like 0.0000278
Further Details:      
 
Domain Number 2 Region: 23-80
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000236
Family MerB N-terminal domain-like 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B4SJS4
Sequence length 223
Comment (tr|A0A1B4SJS4|A0A1B4SJS4_9BURK) Alkylmercury lyase {ECO:0000313|EMBL:AOK51010.1} KW=Complete proteome OX=1637831 OS=Burkholderia sp. MSMB617WGS. GN=WT60_18625 OC=Burkholderiaceae; Burkholderia; pseudomallei group.
Sequence
MDRYATDLIDRLTQADRPEGFGQLFVALLRELAKGSPVSPAALAAALAWPRERVAAMLGH
AVDMEWDDDGNVVGYGLTLRQTAHALDVGGRRLYTWCAFDAFFFPMLIGQTAHVVSRCAA
TGEPVTLTVAAKQGGLLNVEPAGAAVSLVSPCGSGPIRAAFCCRVHFFASAEIGRAWAST
QPGVDIVDARMAFNVGYACAQHLLQAVRGRQPGGGCHEAFERS
Download sequence
Identical sequences A0A1B4SJS4
WP_060356446.1.1748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]