SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B4XLN1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B4XLN1
Domain Number 1 Region: 244-307
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 1.6e-18
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0032
Further Details:      
 
Weak hits

Sequence:  A0A1B4XLN1
Domain Number - Region: 82-102
Classification Level Classification E-value
Superfamily BEACH domain 0.0405
Family BEACH domain 0.01
Further Details:      
 
Domain Number - Region: 123-222
Classification Level Classification E-value
Superfamily ADC synthase 0.0778
Family ADC synthase 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B4XLN1
Sequence length 321
Comment (tr|A0A1B4XLN1|A0A1B4XLN1_ENTFL) Helix-turn-helix transcriptional regulator {ECO:0000313|EMBL:OGX75136.1} KW=Complete proteome OX=1351 OS=Enterococcus faecalis (Streptococcus faecalis). GN=A6B47_03170 OC=Enterococcus.
Sequence
MTFVFIYNILLIILYSFTSTFTLNLYLKNKQPIFLLLLFLMVIFICDNVIVYMTEFINSF
ATEYNQTFMTAPFLKTIIFICCNFAYLAIINTISGRPFKNYQFVWLFLIGLWMLAIPFSQ
NSALKVWLYYLPNQLFLIYLGCYALYQLRIDPLSALAKKYLRFIGWLSIGFGVAILLEDT
FVIFNIDQYSDIVFKINNRNVSEDIYTIILSIAIIYFCNRDFPLSVLEKDAAKLEENQSD
EPVLLAPFCDAYQLTQREREVLSLLLECKTNQDIANELFLSIGTVKTHIHNIFVKLEVNK
RAEVFVSYQLFSQQQTEHLAR
Download sequence
Identical sequences A0A0H1TM48 A0A0M2AW08 A0A0M2CKR4 A0A0U1AV36 A0A1B4XLN1 C7CXR3 R3H3Q3 R3KPB1 V7ZS45
gi|384517794|ref|YP_005705099.1| gi|384512432|ref|YP_005707525.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]