SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B5DEJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B5DEJ6
Domain Number 1 Region: 3-130
Classification Level Classification E-value
Superfamily FlgN-like 2.22e-27
Family FlgN-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B5DEJ6
Sequence length 156
Comment (tr|A0A1B5DEJ6|A0A1B5DEJ6_9PSED) FlgN protein {ECO:0000313|EMBL:CRM36187.1} KW=Complete proteome OX=1844105 OS=Pseudomonas sp. 44 R 15. GN= OC=Pseudomonadaceae; Pseudomonas.
Sequence
MHHDEHLLQLIIDDLAPTQQLLELLKEESLALYGRDMPLLEEILARKQSLIVLLEQHGTK
RSEILNSLGLPADHDGLAQLASHSSVGDQLLTQSKALNHLLTQCQEANLLNGQSIQLQQA
TTANQLRILHGGEPPALYNAQGSTSRLVKPSTRSQA
Download sequence
Identical sequences A0A1B5DEJ6
WP_065892956.1.12410 WP_065892956.1.30624 WP_065892956.1.74404 WP_065892956.1.98872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]