SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B6CU45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B6CU45
Domain Number 1 Region: 6-272
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 1.96e-78
Family Protein prenylyltransferase 0.000000059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B6CU45
Sequence length 278
Comment (tr|A0A1B6CU45|A0A1B6CU45_9HEMI) Uncharacterized protein {ECO:0000313|EMBL:JAS16753.1} OX=38151 OS=Clastoptera arizonana (Arizona spittle bug). GN=g.24981 OC=Cercopoidea; Clastopteridae; Clastoptera.
Sequence
MHLVQDVFDYFRAILKSGEKSVRALKLTQDAVSLNPANYTVWQYRREILQAINSDLKAEL
AYVKTVIDEHPKNYQVWHHRRVVVEWLNDPEDELNITAEVLEIDAKNYHAWQHRQWVVHT
FGLFENELDYVTKLLNEDVRNNSAWNQRYFVLSNISNFTANLIEKEIVYTISKIISVTKN
ESSWNYLRGLLLHSEHGLNHPITIKFCEELYDSGHRSPYLLAFLVDHAEEMIEKGDINKI
KFLNLSLKLCKELGEEHDTIRQEYWKYLAKRIKESAQE
Download sequence
Identical sequences A0A1B6CU45

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]