SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B6H3S4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B6H3S4
Domain Number 1 Region: 2-157
Classification Level Classification E-value
Superfamily BEACH domain 4.32e-66
Family BEACH domain 0.00000385
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B6H3S4
Sequence length 195
Comment (tr|A0A1B6H3S4|A0A1B6H3S4_9HEMI) Uncharacterized protein {ECO:0000313|EMBL:JAS69298.1} OX=1464854 OS=Cuerna arida. GN=g.576 OC=Membracoidea; Cicadellidae; Cicadellinae; Cuerna.
Sequence
LADRMFNSVREAWLSASRHNMADVKELIPEFFYLPEFLCNSNNFDLGCKQNGVQLGDVVL
PPWAKEDPREFIRVHRQALECDYVSQHLHEWIDLIFGHKQQGPAAVDSVNLFHHLFYEGN
VDIYSIDDPLKKNATIGFINNFGQIPKQLFKKPHPAKKLNHRSSVLDPGPLNTPLMSERL
FYHNLDNLKPSLQPI
Download sequence
Identical sequences A0A1B6H3S4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]